H00091754-M01
antibody from Abnova Corporation
Targeting: NEK9
DKFZp434D0935, MGC16714, Nek8, NERCC, NERCC1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00091754-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00091754-M01, RRID:AB_534959
- Product name
- NEK9 monoclonal antibody (M01), clone 1F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NEK9.
- Antigen sequence
AGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQ
QKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQ
TAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL- Isotype
- IgG
- Antibody clone number
- 1F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references First insight into the kinome of human regulatory T cells.
König S, Probst-Kepper M, Reinl T, Jeron A, Huehn J, Schraven B, Jänsch L
PloS one 2012;7(7):e40896
PloS one 2012;7(7):e40896
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NEK9 monoclonal antibody (M01), clone 1F6 Western Blot analysis of NEK9 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6.Lane 1: NEK9 transfected lysate(107.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NEK9 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to NEK9 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol