HPA001405

NEK9 antibody from Sigma-Aldrich
DKFZp434D0935, MGC16714, Nek8, NERCC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001405
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001405, RRID:AB_1079467
Product name
Anti-NEK9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001405
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase Nek9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTER
PHGSDICTSWPRPIFGSLHHVPDLSCRGWHTILIV
EKVLNSKTIRSNSSGLSIGTVFQSSSPGGGGGGGG
GEEEDSQQESETPDPSGGFRGTMEADRGMEGLISP
TEAM
Storage
-20C
Provider Type Product Number
- No reagents -