Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29333 - Provider product page

- Provider
- Abnova Corporation
- Product name
- CD34 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human CD34.
- Antigen sequence
LNEPNTFSPANVDASVMYRKWKESKGKDREYTDII
RKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPD
EGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGT- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Human cell line RT-4 with CD34 polyclonal antibody (Cat# PAB29333) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251 MG with CD34 polyclonal antibody (Cat# PAB29333) under 1-4 ug/mL working concentration shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney with CD34 polyclonal antibody (Cat# PAB29333) shows strong cytoplasmic positivity in cells of tubules at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)