HPA002382

CDC34 antibody from Sigma-Aldrich
E2-CDC34, UBC3, UBE2R1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002382
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002382, RRID:AB_1846370
Product name
Anti-CDC34 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002382
Antibody type
Polyclonal
Antigen
Ubiquitin-conjugating enzyme E2 R1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNEPNTFSPANVDASVMYRKWKESKGKDREYTDII
RKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPD
EGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGT
Storage
-20C
Provider Type Product Number
- No reagents -