H00000104-B01

ADARB1 antibody from Abnova Corporation
ADAR2, ADAR2a, ADAR2a-L1, ADAR2a-L2, ADAR2a-L3, ADAR2b, ADAR2c, ADAR2d, ADAR2g, DRABA2, DRADA2, hRED1, RED1

Antibody data

Product number
H00000104-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000104-B01, RRID:AB_1203938
Product name
ADARB1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00000104-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ADARB1 protein.
Antigen sequence
MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGP
GEGSQLSNGGGGGPGRKRPLEEGSNGHSKYRLKKR
RKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVH
APLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALR
SFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDT
LFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSA
SPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRP
GLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRN
KKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGL
QLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRK
VLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSD
RGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD
QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDAR
IFSPHEPILEGSRSYTQAGVQWCNHGSLQPRPPGL
LSDPSTSTFQGAGTTEPADRHPNRKARGQLRTKIE
SGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKI
ARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDH
LSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEAR
QPGKAPNFSVNWTVGDSAIEVINATTGKDELGRAS
RLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHE
SKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQD
QFSLTP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -