HPA019885

IL17RC antibody from Sigma-Aldrich
IL17-RL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019885
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019885, RRID:AB_1851664
Product name
Anti-IL17RC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019885
Antibody type
Polyclonal
Antigen
Interleukin-17 receptor C Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQK
ETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADS
GVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPA
ALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRY
EKELNH
Storage
-20C
Provider Type Product Number
- No reagents -