Antibody data

Product number
ABIN404793
Provider
antibodies-online
Product name
anti-Inhibitor of DNA Binding 4, Dominant Negative Helix-Loop-Helix Protein (ID4) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404793
Antibody type
Polyclonal
Antigen
The immunogen for anti-ID4 antibody: synthetic peptide directed towards the middle region of human ID4
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQ
LALET HPALLRQPPP
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -