Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404793 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Inhibitor of DNA Binding 4, Dominant Negative Helix-Loop-Helix Protein (ID4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ID4 antibody: synthetic peptide directed towards the middle region of human ID4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQ
LALET HPALLRQPPP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references t(6;14)(p22;q32): a new recurrent IGH@ translocation involving ID4 in B-cell precursor acute lymphoblastic leukemia (BCP-ALL).
Russell LJ, Akasaka T, Majid A, Sugimoto KJ, Loraine Karran E, Nagel I, Harder L, Claviez A, Gesk S, Moorman AV, Ross F, Mazzullo H, Strefford JC, Siebert R, Dyer MJ, Harrison CJ
Blood 2008 Jan 1;111(1):387-91
Blood 2008 Jan 1;111(1):387-91
No comments: Submit comment
No validations: Submit validation data