ARP50323_P050

ZNF783 antibody from Aviva Systems Biology
DKFZp667J212
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
ARP50323_P050
Provider
Aviva Systems Biology
Proper citation
Aviva Systems Biology Cat#ARP50323_P050, RRID:AB_10568991
Product name
Anti-KIAA0020
Provider product page
Aviva Systems Biology - ARP50323_P050
Antibody type
Polyclonal
Antigen
Synthetic peptide
Description
This is a rabbit polyclonal antibody against KIAA0020. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment; please inquire (info@avivasysbio.com).
Reactivity
Human, Bovine, Canine
Host
Rabbit
Antigen sequence
Antigen corresponding to the follow
ing peptide sequence: EVKGKKQFTGKST
KTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVT
SR
Isotype
IgG
Vial size
50ug
Concentration
1 mg/ml
Handling
Add 50 μl of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage; store at -20°C. Avoid repeat freeze-thaw cycles.
Provider Type Product Number
- No reagents -