Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310481 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ECH1 antibody: synthetic peptide directed towards the N terminal of human ECH1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVF
WREMV ECFNKISRDA- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Enhanced peroxisomal β-oxidation metabolism in visceral adipose tissues of high-fat diet-fed obesity-resistant C57BL/6 mice.
A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
Xie WD, Wang H, Zhang JF, Li JN, Can Y, Qing L, Kung HF, Zhang YO
Experimental and therapeutic medicine 2011 Mar;2(2):309-315
Experimental and therapeutic medicine 2011 Mar;2(2):309-315
A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
Goehler H, Lalowski M, Stelzl U, Waelter S, Stroedicke M, Worm U, Droege A, Lindenberg KS, Knoblich M, Haenig C, Herbst M, Suopanki J, Scherzinger E, Abraham C, Bauer B, Hasenbank R, Fritzsche A, Ludewig AH, Büssow K, Coleman SH, Gutekunst CA, Landwehrmeyer BG, Lehrach H, Wanker EE
Molecular cell 2004 Sep 24;15(6):853-65
Molecular cell 2004 Sep 24;15(6):853-65
No comments: Submit comment
No validations: Submit validation data