HPA002907

ECH1 antibody from Sigma-Aldrich
HPXEL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002907
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002907, RRID:AB_1847964
Product name
Anti-ECH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002907
Antibody type
Polyclonal
Antigen
Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSA
QKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISR
DADCRAVVISGAGKMFTAGIDLMDMASDILQPKGD
DVARISWYLRDIITRYQETFNVIERCPK
Storage
-20C
Provider Type Product Number
- No reagents -