HPA005513

BIRC2 antibody from Atlas Antibodies
API1, c-IAP1, cIAP1, hiap-2, MIHB, RNF48
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005513
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005513, RRID:AB_1846746
Product name
Anti-BIRC2
Provider product page
Atlas Antibodies - HPA005513
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSK
NTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPL
NSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPL
TFLSPSELARAGF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -