HPA005513

BIRC2 antibody from Sigma-Aldrich
API1, c-IAP1, cIAP1, hiap-2, MIHB, RNF48
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005513
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005513, RRID:AB_1846746
Product name
Anti-BIRC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005513
Antibody type
Polyclonal
Antigen
Baculoviral IAP repeat-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSK
NTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPL
NSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPL
TFLSPSELARAGF
Storage
-20C
Provider Type Product Number
- No reagents -