HPA002383

CARS1 antibody from Atlas Antibodies
CARS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002383
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002383, RRID:AB_1078399
Product name
Anti-CARS
Provider product page
Atlas Antibodies - HPA002383
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SQCNLYMAARKAVRKRPNQALLENIALYLTHMLKI
FGAVEEDSSLGFPVGGPGTSLSLEATVMPYLQVLS
EFREGVRKIAREQKVPEILQLSDALRDNILPELGV
RFEDHEGLPTVVKLVDRNTLLKEREEKRRVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -