H00003440-M39A

IFNA2 antibody from Abnova Corporation
IFN-alphaA, IFNA
No application information provided.

Antibody data

Product number
H00003440-M39A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003440-M39A, RRID:AB_1204527
Product name
IFNA2 monoclonal antibody (M39A), clone 1D3
Provider product page
Abnova Corporation - H00003440-M39A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant IFNA2.
Antigen sequence
MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHD
FGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTK
DSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGV
TETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW
EVVRAEIMRSFSLSTNLQESLRSKE
Isotype
IgG
Antibody clone number
1D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -