HPA015285

TULP3 antibody from Sigma-Aldrich
TUBL3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015285
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015285, RRID:AB_1858460
Product name
Anti-TULP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015285
Antibody type
Polyclonal
Antigen
Tubby-related protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGTSGSATAAQPADNLLGDIDDLEDFVYSPAPQGV
TVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFL
LAARKRKKSKTANYLISIDPVDLSREGESYVGK
Storage
-20C
Provider Type Product Number
- No reagents -