Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28571 - Provider product page

- Provider
- Abnova Corporation
- Product name
- HYAL1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant HYAL1.
- Antigen sequence
SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAG
TLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQ
CPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGT
GKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIF
YDTTNHF- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: Liver and lane 4: Tonsil using HYAL1 polyclonal antibody (Cat # PAB28571).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of A-431 cell line with HYAL1 polyclonal antibody (Cat # PAB28571) shows positivity in cytoplasm. Fixation/Permeabilization: PFA/Triton X-101
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human uterine corpus with HYAL1 polyclonal antibody (Cat # PAB28571) shows strong cytoplasmic positivity in glandular cells. Retrieval method: HIER pH6
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)