Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003373-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003373-A01, RRID:AB_606422
- Product name
- HYAL1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HYAL1.
- Antigen sequence
ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFG
GLPQNASLIAHLARTFQDILAAIPAPDFSGLAVID
WEAWRPRWAFNWDTKDIYRQRSRALVQAQH- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hyaluronan synthases and hyaluronidases in nasal polyps.
Panogeorgou T, Tserbini E, Filou S, Vynios DH, Naxakis SS, Papadas TA, Goumas PD, Mastronikolis NS
European archives of oto-rhino-laryngology : official journal of the European Federation of Oto-Rhino-Laryngological Societies (EUFOS) : affiliated with the German Society for Oto-Rhino-Laryngology - Head and Neck Surgery 2016 Jul;273(7):1801-8
European archives of oto-rhino-laryngology : official journal of the European Federation of Oto-Rhino-Laryngological Societies (EUFOS) : affiliated with the German Society for Oto-Rhino-Laryngology - Head and Neck Surgery 2016 Jul;273(7):1801-8
No comments: Submit comment
No validations: Submit validation data