Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503191 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Hyaluronidase-1 (HYAL1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
TIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHL
ARTFQ DILAAIPAPD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular risk assessment for breast cancer development in patients with ductal hyperplasias.
Poola I, Abraham J, Marshalleck JJ, Yue Q, Lokeshwar VB, Bonney G, Dewitty RL
Clinical cancer research : an official journal of the American Association for Cancer Research 2008 Feb 15;14(4):1274-80
Clinical cancer research : an official journal of the American Association for Cancer Research 2008 Feb 15;14(4):1274-80
No comments: Submit comment
No validations: Submit validation data