HPA002112

HYAL1 antibody from Atlas Antibodies
HYAL-1, LUCA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002112
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002112, RRID:AB_1857412
Product name
Anti-HYAL1
Provider product page
Atlas Antibodies - HPA002112
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAG
TLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQ
CPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGT
GKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIF
YDTTNHF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -