HPA002112

HYAL1 antibody from Sigma-Aldrich
FUS2, HYAL-1, LUCA1, NAT6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002112
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002112, RRID:AB_1857412
Product name
Anti-HYAL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002112
Antibody type
Polyclonal
Antigen
Hyaluronidase-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAG
TLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQ
CPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGT
GKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIF
YDTTNHF
Storage
-20C
Provider Type Product Number
- No reagents -