ABIN310737

POFUT2 antibody from antibodies-online
C21orf80, FUT13, KIAA0958

Antibody data

Product number
ABIN310737
Provider
antibodies-online
Product name
anti-Protein O-Fucosyltransferase 2 (POFUT2) (C-Term) antibody
Provider product page
antibodies-online - ABIN310737
Antibody type
Polyclonal
Antigen
The immunogen for anti-POFUT2 antibody: synthetic peptide directed towards the C terminal of human POFUT2
Description
Protein A purified
Reactivity
Human
Host
Rabbit
Antigen sequence
RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSL
SAESG SGGFQRFFCP
Epitope
C-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -