Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182575 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the C terminal of human PSMD14
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSN
IVQCL AAMLDTVVFK- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Resistance to diverse drugs and ultraviolet light conferred by overexpression of a novel human 26 S proteasome subunit.
Spataro V, Toda T, Craig R, Seeger M, Dubiel W, Harris AL, Norbury C
The Journal of biological chemistry 1997 Nov 28;272(48):30470-5
The Journal of biological chemistry 1997 Nov 28;272(48):30470-5
No comments: Submit comment
No validations: Submit validation data