Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002114 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002114, RRID:AB_1855850
- Product name
- Anti-PSMD14
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLML
GEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQA
KMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDIN
TQQSFEALSERAVAVVVDPIQSVKGKVVIDA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references POH1 deubiquitylates and stabilizes E2F1 to promote tumour formation.
Multiple components of the spliceosome regulate Mcl1 activity in neuroblastoma.
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Wang B, Ma A, Zhang L, Jin WL, Qian Y, Xu G, Qiu B, Yang Z, Liu Y, Xia Q, Liu Y
Nature communications 2015 Oct 29;6:8704
Nature communications 2015 Oct 29;6:8704
Multiple components of the spliceosome regulate Mcl1 activity in neuroblastoma.
Laetsch TW, Liu X, Vu A, Sliozberg M, Vido M, Elci OU, Goldsmith KC, Hogarty MD
Cell death & disease 2014 Feb 20;5(2):e1072
Cell death & disease 2014 Feb 20;5(2):e1072
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows strong nuclear positivity in neuronal cells.
- Sample type
- HUMAN