Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108776 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the C terminal of human PSMD14.
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSN
IVQCLAAMLDTVVFK- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Resistance to diverse drugs and ultraviolet light conferred by overexpression of a novel human 26 S proteasome subunit.
Spataro V, Toda T, Craig R, Seeger M, Dubiel W, Harris AL, Norbury C
The Journal of biological chemistry 1997 Nov 28;272(48):30470-5
The Journal of biological chemistry 1997 Nov 28;272(48):30470-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-PSMD14 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate. PSMD14 is supported by BioGPS gene expression data to be expressed in HepG2.; PSMD14 antibody - C-terminal region (AP42115PU-N) in Human HepG2 cells using Western Blot
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HeLa, Mouse liver; . Lanes: 1. 100 ug HeLa cell lysate. 2. 100 ug mouse liver cytosolic extract 3. 1.5 ug human 26S Proteasome. Primary Antibody Dilution: 1:1000. Secondary Antibody: Anti-Rabbit AP. Secondary Antibody Dilution: 1:10000. Gene Name: PSMD14. Submitted by: Anonymous.; PSMD14 antibody - C-terminal region (AP42115PU-N) in Human HeLa, Mouse liver cells using Western Blot
