HPA002114

PSMD14 antibody from Sigma-Aldrich
pad1, POH1, Rpn11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002114
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002114, RRID:AB_1855850
Product name
Anti-PSMD14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002114
Antibody type
Polyclonal
Antigen
26S proteasome non-ATPase regulatory subunit 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLML
GEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQA
KMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDIN
TQQSFEALSERAVAVVVDPIQSVKGKVVIDA
Storage
-20C
Provider Type Product Number
- No reagents -