Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310565 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC19A1 antibody: synthetic peptide directed towards the N terminal of human SLC19A1
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFY
GFMAQ IRPGESFITP- Vial size
- 0.1 mg
Submitted references The antiepileptic drugs phenobarbital and carbamazepine reduce transport of methotrexate in rat choroid plexus by down-regulation of the reduced folate carrier.
Pralatrexate is synergistic with the proteasome inhibitor bortezomib in in vitro and in vivo models of T-cell lymphoid malignancies.
Transcriptional regulation of the human reduced folate carrier A1/A2 promoter: Identification of critical roles for the USF and GATA families of transcription factors.
Halwachs S, Lakoma C, Schäfer I, Seibel P, Honscha W
Molecular pharmacology 2011 Oct;80(4):621-9
Molecular pharmacology 2011 Oct;80(4):621-9
Pralatrexate is synergistic with the proteasome inhibitor bortezomib in in vitro and in vivo models of T-cell lymphoid malignancies.
Marchi E, Paoluzzi L, Scotto L, Seshan VE, Zain JM, Zinzani PL, O'Connor OA
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Jul 15;16(14):3648-58
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Jul 15;16(14):3648-58
Transcriptional regulation of the human reduced folate carrier A1/A2 promoter: Identification of critical roles for the USF and GATA families of transcription factors.
Payton SG, Liu M, Ge Y, Matherly LH
Biochimica et biophysica acta 2005 Nov 10;1731(2):115-24
Biochimica et biophysica acta 2005 Nov 10;1731(2):115-24
No comments: Submit comment
No validations: Submit validation data