HPA024154

ZNF862 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024154
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024154, RRID:AB_1859469
Product name
Anti-ZNF862 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024154
Antibody type
Polyclonal
Antigen
Zinc finger protein 862 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GICLDKLEVAEQRFQADRERTVLTGIEYLQQRFDA
DRPPQLKNMEVFDTMAWPSGIELASFGNDDILNLA
RYFECSLPTGYSEEALLEEWLGLKTIAQHLPFSML
CKNALAQHCRFPLLSKLMAVVVCVPIST
Storage
-20C
Provider Type Product Number
- No reagents -