HPA063001

antibody from Atlas Antibodies

Targeting: ELAVL2 HEL-N1, HuB

Antibody data

Submit

Validation data

Product number: HPA063001 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA063001, RRID:AB_2684918
Product name: Anti-ELAVL2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLS NGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ELAVL2 protein structure - HPA063001 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA063001 antibody. Corresponding ELAVL2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells, subset of glial cells showed strong nuclear staining.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN