HPA023879

ARID5A antibody from Atlas Antibodies
MRF-1, RP11-363D14
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023879
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023879, RRID:AB_1845014
Product name
Anti-ARID5A
Provider product page
Atlas Antibodies - HPA023879
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGD
DGATERPKKAKEERRMDQMMPGKTKADAADPAPLP
SQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRL
LSSFYCKGTH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -