H00010865-B01P

ARID5A antibody from Abnova Corporation
MRF-1, RP11-363D14

Antibody data

Product number
H00010865-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010865-B01P, RRID:AB_1571351
Product name
ARID5A purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010865-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ARID5A protein.
Antigen sequence
MAKENRGDDGATERPKKAKEERRMDQMMPGKTKAD
AADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASG
CPEAYKRLLSSFYCKGTHGIMSPLAKKKLLAQVSK
VEALQCQEEGCRHGAEPQASPAVHLPESPQSPKGL
TENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPI
FKGCFYTHPTEVLKPVSQHPRDFFSRLKDGVLLGP
PGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGIL
YPKPKACWVSPMAKVPAESPTLPPTFPSSPGLGSK
RSLEEEGAAHSGKRLRAVSPFLKEADAKKCGAKPA
GSGLVSCLLGPALGPVPPEAYRGTMLHCPLNFTGT
PGPLKGQAALPFSPLVIPAFPAHFLATAGPSPMAA
GLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAA
PHFFHLNTKL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -