Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449846 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-AT Rich Interactive Domain 5A (MRF1-Like) (ARID5A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ARID4A antibody: synthetic peptide directed towards the N terminal of human ARID5A
- Description
- Purified using peptide immnunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
LWKNVYDELGGSPGSTSAATCTRRHYERLVLPYVR
HLKGEDDKPLPTSKP- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Prior to reconstitution store at 2-8°C. Following reconstitution store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- 721_B; Host: Rabbit. Target Name:ARID5A. Sample Tissue:721_B. Lane A: Primary Antibody . Lane B: Primary Antibody + Blocking Peptide . Primary Antibody Concentration:1ug/ml. Peptide Concentration: 5ug/ml. Lysate Quantity: 25ug/lane/lane. Gel Concentration: 0.12.; ARID5A antibody - N-terminal region (AP43736PU-N) in 721_B cells using Western Blot
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human 721_B; WB Suggested Anti-ARID5A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 721_B cell lysate. ARID5A is supported by BioGPS gene expression data to be expressed in 721_B.; ARID5A antibody - N-terminal region (AP43736PU-N) in Human 721_B cells using Western Blot