HPA023879

ARID5A antibody from Sigma-Aldrich
MRF-1, RP11-363D14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023879
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023879, RRID:AB_1845014
Product name
Anti-ARID5A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023879
Antibody type
Polyclonal
Antigen
AT-rich interactive domain-containing protein 5A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGD
DGATERPKKAKEERRMDQMMPGKTKADAADPAPLP
SQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRL
LSSFYCKGTH
Storage
-20C
Provider Type Product Number
- No reagents -