HPA042416

antibody from Atlas Antibodies

Targeting: PRL

Antibody data

Submit

Validation data

Product number: HPA042416 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042416, RRID:AB_2677987
Product name: Anti-PRL
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIV SQVHPETKENEIYPVWSGLPSLQMADEESRLSAYY NLLHCLRRDSHKIDNYLKLLKCRIIHNNN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PRL protein structure - HPA042416 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, lymph node and pituitary gland using Anti-PRL antibody HPA042416 (A) shows similar protein distribution across tissues to independent antibody HPA062017 (B).
Antibody #2 product nr: HPA062017
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pituitary gland using Anti-PRL antibody HPA042416.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-PRL antibody HPA042416.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PRL antibody HPA042416.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-PRL antibody HPA042416.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pituitary gland shows strong positivity.
Sample type: HUMAN