Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91429 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91429, RRID:AB_2732090
- Product name
- Anti-PRL
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIV
SQVHPETKENEIYPVWSGLPSLQMADEESRLSAYY
NLLHCLRRDSHKIDNYLKLLKCRIIHNNN- Epitope
- Binds to an epitope located within the peptide sequence HKIDNYLKLLKCRII as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL6550
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human pituitary gland tissue.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pituitary gland shows strong cytoplasmic positivity in a subset of neuroendocrine cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.