Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039747 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA039747, RRID:AB_2732482
- Product name
- Anti-PRMT8
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQ
PVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEM
TSRDYY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references PRMT8 demonstrates variant-specific expression in cancer cells and correlates with patient survival in breast, ovarian and gastric cancer
Hernandez S, Dolivo D, Dominko T
Oncology Letters 2017;13(3):1983-1989
Oncology Letters 2017;13(3):1983-1989
No comments: Submit comment
No validations: Submit validation data