Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309998 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Protein Arginine Methyltransferase 8 (PRMT8) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRMT8 antibody: synthetic peptide directed towards the C terminal of human PRMT8
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVD
LDFKG QLCETSVSND- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references PRMT8, a new membrane-bound tissue-specific member of the protein arginine methyltransferase family.
Lee J, Sayegh J, Daniel J, Clarke S, Bedford MT
The Journal of biological chemistry 2005 Sep 23;280(38):32890-6
The Journal of biological chemistry 2005 Sep 23;280(38):32890-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- WB Suggested Anti-PRMT8 Antibody Titration: 2.5 μg/mL ELISA Titer: 1:.12500 Positive Control: Transfected 293T