HPA001897

ILF3 antibody from Atlas Antibodies
DRBP76, MPHOSPH4, MPP4, MPP4110, NF110, NF110b, NF90, NF90a, NF90c, NF90ctv, NFAR-1, NFAR-2, NFAR110, NFAR90, TCP110
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001897
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001897, RRID:AB_1078703
Product name
Anti-ILF3
Provider product page
Atlas Antibodies - HPA001897
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDW
IDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTE
HMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKE
KPTTALLDKVADNLAIQLAAVTEDKYEILQSVDDA
AIVIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -