AV40522

ILF3 antibody from Sigma-Aldrich
DRBP76, MPHOSPH4, MPP4, MPP4110, NF110, NF110b, NF90, NF90a, NF90c, NF90ctv, NFAR-1, NFAR-2, NFAR110, NFAR90, TCP110
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV40522
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV40522, RRID:AB_1851745
Product name
Anti-ILF3 (AB3) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV40522
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ILF3 with an internal ID of P22718
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPE
DDSKEGAGEQKTEHM
Storage
-20C
Provider Type Product Number
- No reagents -