HPA001897

ILF3 antibody from Sigma-Aldrich
DRBP76, MPHOSPH4, MPP4, NF90, NFAR-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001897
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001897, RRID:AB_1078703
Product name
Anti-ILF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001897
Antibody type
Polyclonal
Antigen
Interleukin enhancer-binding factor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDW
IDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTE
HMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKE
KPTTALLDKVADNLAIQLAAVTEDKYEILQSVDDA
AIVIK
Storage
-20C
Provider Type Product Number
- No reagents -