PAB21638

CAAP1 antibody from Abnova Corporation
C9orf82, CAAP, FLJ13657

Antibody data

Product number
PAB21638
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21638, RRID:AB_10964310
Product name
C9orf82 polyclonal antibody
Provider product page
Abnova Corporation - PAB21638
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C9orf82.
Antigen sequence
STDSSSVSGSLQQETKYILPTLEKELFLAEHSDLE
EGGLDLTVSLKPVSFYISDKKEMLQQCFCIIGEKK
LQKMLPDVLKNCS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -