HPA024029

CAAP1 antibody from Sigma-Aldrich
C9orf82, CAAP, FLJ13657
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024029
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024029, RRID:AB_1845842
Product name
Anti-C9orf82 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024029
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf82 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STDSSSVSGSLQQETKYILPTLEKELFLAEHSDLE
EGGLDLTVSLKPVSFYISDKKEMLQQCFCIIGEKK
LQKMLPDVLKNCS
Storage
-20C
Provider Type Product Number
- No reagents -