HPA002694

DNMT1 antibody from Sigma-Aldrich
CXXC9, DNMT, MCMT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002694
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002694, RRID:AB_1847810
Product name
Anti-DNMT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002694
Antibody type
Polyclonal
Antigen
DNA (cytosine-5)-methyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAG
TDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVI
YKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYD
QDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQK
EIPRVL
Storage
-20C
Provider Type Product Number
- No reagents -