Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310251 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTA
TPGNS VGFLLRPFNF- Vial size
- 50 µg
Submitted references Estrogen regulates amiloride-binding protein 1 through CCAAT/enhancer-binding protein-beta in mouse uterus during embryo implantation and decidualization.
Association between plasma activities of semicarbazide-sensitive amine oxidase and angiotensin-converting enzyme in patients with type 1 diabetes mellitus.
Liang XH, Zhao ZA, Deng WB, Tian Z, Lei W, Xu X, Zhang XH, Su RW, Yang ZM
Endocrinology 2010 Oct;151(10):5007-16
Endocrinology 2010 Oct;151(10):5007-16
Association between plasma activities of semicarbazide-sensitive amine oxidase and angiotensin-converting enzyme in patients with type 1 diabetes mellitus.
Boomsma F, Pedersen-Bjergaard U, Agerholm-Larsen B, Hut H, Dhamrait SS, Thorsteinsson B, van den Meiracker AH
Diabetologia 2005 May;48(5):1002-7
Diabetologia 2005 May;48(5):1002-7
No comments: Submit comment
No validations: Submit validation data