HPA002735

TERF2 antibody from Sigma-Aldrich
TRBF2, TRF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002735
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002735, RRID:AB_1857898
Product name
Anti-TERF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002735
Antibody type
Polyclonal
Antigen
Telomeric repeat-binding factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGEN
LDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVV
ESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKD
PTTQKLRNDLLNIIREKNLAHPVIQNF
Storage
-20C
Provider Type Product Number
- No reagents -