HPA026895

PARP11 antibody from Sigma-Aldrich
C12orf6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026895
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026895, RRID:AB_1854980
Product name
Anti-PARP11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026895
Antibody type
Polyclonal
Antigen
Poly recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SISAFSYICENEAIPMPPHWENVNTQVPYQLIPLH
NQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWE
FFCRK
Storage
-20C
Provider Type Product Number
- No reagents -