HPA024049

DCTN6 antibody from Sigma-Aldrich
WS-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024049
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024049, RRID:AB_1847524
Product name
Anti-DCTN6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024049
Antibody type
Polyclonal
Antigen
Dynactin subunit 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIP
ENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPN
YHHLKKTMKGSSTPVKN
Storage
-20C
Provider Type Product Number
- No reagents -