HPA013349

APC antibody from Sigma-Aldrich
DP2, DP2.5, DP3, PPP1R46
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013349
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013349, RRID:AB_1844913
Product name
Anti-APC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013349
Antibody type
Polyclonal
Antigen
Adenomatous polyposis coli protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWA
RPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDK
HLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHG
INQNVSQSLCQEDDYEDDKP
Storage
-20C
Provider Type Product Number
- No reagents -