Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021136 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-KLB
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GDMDIYITASGIDDQALEDDRLRKYYLGKYLQEVL
KAYLIDKVRIKGYYAFKLAEEKSKPRFGFFTSDFK
AKSSIQFYNKVISSRGFPFENSSSRCSQTQENT- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Decreased placental and muscular expression of the fibroblast growth factor 19 in gestational diabetes mellitus
Peripherally derived FGF21 promotes remyelination in the central nervous system
Wang D, Xu S, Ding W, Zhu C, Deng S, Qiu X, Wang Z
Journal of Diabetes Investigation 2018;10(1):171-181
Journal of Diabetes Investigation 2018;10(1):171-181
Peripherally derived FGF21 promotes remyelination in the central nervous system
Kuroda M, Muramatsu R, Maedera N, Koyama Y, Hamaguchi M, Fujimura H, Yoshida M, Konishi M, Itoh N, Mochizuki H, Yamashita T
Journal of Clinical Investigation 2017;127(9):3496-3509
Journal of Clinical Investigation 2017;127(9):3496-3509
No comments: Submit comment
No validations: Submit validation data