HPA001908

LAMC1 antibody from Atlas Antibodies
LAMB2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001908
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001908, RRID:AB_1079229
Product name
Anti-LAMC1
Provider product page
Atlas Antibodies - HPA001908
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ECREGFVGNRCDQCEENYFYNRSWPGCQECPACYR
LVKDKVADHRVKLQELESLIANLGTGDEMVTDQAF
EDRLKEAEREVMDLLREAQDVKDVDQNLMDRLQRV
NNTLSSQISRLQNIRNTIEETGNLAEQARAHVENT
ERLIEIASR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -