HPA019036

XK antibody from Sigma-Aldrich
Kx, NA, NAC, X1k, XKR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019036
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019036, RRID:AB_1846286
Product name
Anti-XK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019036
Antibody type
Polyclonal
Antigen
Membrane transport protein XK recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGN
NEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLI
THRSAFSRA
Storage
-20C
Provider Type Product Number
- No reagents -